PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00045.1.g03050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 458aa    MW: 50384.3 Da    PI: 9.322
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00045.1.g03050.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.6e-3370124155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Zjn_sc00045.1.g03050.1.am.mk  70 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 124
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS517368.673129IPR006119Resolvase, N-terminal catalytic domain
PROSITE profilePS5129412.34767127IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-3267125IPR009057Homeodomain-like
SuperFamilySSF466892.33E-1669125IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2370125IPR006447Myb domain, plants
PfamPF002491.6E-772122IPR001005SANT/Myb domain
PfamPF143791.4E-25165211IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006310Biological ProcessDNA recombination
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000150Molecular Functionrecombinase activity
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MYSTRREERE LIRERSRGEG GGAAARARGR GENRMFPSKK ATSAAAAVSS NDRQMCVQGD  60
SGLVLTTDPK PRLRWTVELH ERFVDAVTQL GGPDKATPKT IMRVMGVKGL TLYHLKSHLQ  120
KFRLGKQPHK EFNDHSVKDA AAMEMQRNVA SSSGMMGRSM NDRNHVNEAI RMQMEVQRRL  180
HEQLEVQKHL QMRIEAQGKY MQSILEKAYQ TLAAGDVMSC PAGYKSLGNQ AVLDVCSLKD  240
IGPSMGFPSL QDLHMYGGGH LDLQQQMDRS MESFFACSDS SIGSLGKKRP NPYAAGKSPM  300
MWGDDEQGKS DHLQMAPPMV DGGIDVMDSI SDVYGDVKPM MSGDSTGSKG FDGKLERPSP  360
RRRMGSPSVL GGQTRNLSYG TGTEFQKLRV SVLRSLHRCP CESAAFEAYH LGTQLGTTAS  420
LPLVVQVVDC TSTDQSCLRL GNRERQDTRS GAVSLVAF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951748.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-105APL_ARATH; Myb family transcription factor APL
TrEMBLK3YTL20.0K3YTL2_SETIT; Uncharacterized protein
STRINGSi017608m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.22e-99G2-like family protein